PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A06G0860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 981aa    MW: 108750 Da    PI: 5.5182
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A06G0860genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.8e-183985148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd++l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
      Gh_A06G0860 39 KGQWTAEEDDILSKAVQRFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 85
                     799****************************9.************986 PP

2Myb_DNA-binding56.37.2e-1891138148
                      TSSS-HH.HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTte.EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++e Edel++++v+++G++ W+tIa++++ gR +kqc++rw+++l
      Gh_A06G0860  91 KGPWSKEqEDELIIELVNKYGPKKWSTIAQHLP-GRIGKQCRERWHNHL 138
                      6899976599***********************.*************97 PP

3Myb_DNA-binding48.52e-15144186145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r +WT+eE++ lv+a++ +G++ W+   + ++ gRt++ +k++w+
      Gh_A06G0860 144 REAWTQEEELALVRAHQIFGNR-WAELTKFLP-GRTDNAIKNHWN 186
                      789*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7033485IPR017930Myb domain
SuperFamilySSF466894.45E-173799IPR009057Homeodomain-like
SMARTSM007171.2E-143887IPR001005SANT/Myb domain
PfamPF002492.4E-153985IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-194090IPR009057Homeodomain-like
CDDcd001673.60E-134285No hitNo description
PROSITE profilePS5129430.94386142IPR017930Myb domain
SuperFamilySSF466891.39E-2888185IPR009057Homeodomain-like
SMARTSM007174.3E-1690140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-2591141IPR009057Homeodomain-like
PfamPF002491.7E-1691138IPR001005SANT/Myb domain
CDDcd001674.83E-1693138No hitNo description
Gene3DG3DSA:1.10.10.602.2E-20142193IPR009057Homeodomain-like
PROSITE profilePS5129418.759143193IPR017930Myb domain
SMARTSM007171.2E-14143191IPR001005SANT/Myb domain
PfamPF002494.3E-13144187IPR001005SANT/Myb domain
CDDcd001672.38E-11146186No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 981 aa     Download sequence    Send to blast
MESDIKVSTL SVGLGSSDGA QRIRPVHGRT SGPTRRSTKG QWTAEEDDIL SKAVQRFKGK  60
NWKKIAECFK DRTDVQCLHR WQKVLNPELV KGPWSKEQED ELIIELVNKY GPKKWSTIAQ  120
HLPGRIGKQC RERWHNHLNP SINREAWTQE EELALVRAHQ IFGNRWAELT KFLPGRTDNA  180
IKNHWNSSVK KKLDSYIASG LLEQLQFPVL ANQSQPMPSS SMRMQSIVDD SGAKCRKESE  240
DISECSQESN MIGCSRSASD LATAAVHTRE QFHLAEMPGV SKERNSSSAP CSEEYYPSFE  300
DVNFSIPEIP CEVGYSSSGD YQFGEHMLIT DDECCRVLFS EAVNDGCFAS ENFTQGSNIV  360
ELGGCTNRSL CQPSDIQPSE TRKTPASQSS LPSRSEVLPT SCCQSFASPS FLSVEDGTLM  420
HGQEQSQLNC QPFGTQEQEF TMNAHDGFIF TNDDHTNDTD LQEQTYLAKD SQKLLVSVNS  480
IGSELSAMLT CPIADDKRNL PVEEDVRGLC YEPPRFPSLD VPFFSCDLVP SGGNMQQEYS  540
PLGIRQLMMS SMNCISPFRL WDSPSWDGSP DAVLKSAAKT FTGTPSILKK RHRDLLSPLS  600
ERRREKKLEI DMTSSLTRDF SRLDVMFDES VTGNTSQVSP SKRKTNARAS IEEKENVCQE  660
FHGSLDNGGD HTEALDDEAQ KKDSNGTNSP GNIKKEAWRT DIKDKTDAHA SEKIIKQPSA  720
VLIEHNVNDL LLFSPDRVGL KADQPLLPSS IRTPRSQCHK SFRAISNQGL SGNACLIVSS  780
PTLKVKNSDG HSISVTAVQC TNSPATLENL ADNAGIDTSI ENYNIFGGTP FRRSIESPSA  840
WKSPWFINSF IPGPRIDTEI TIEDIGYVMS PAERSYDAIG LMKQLSEHTA AAYADALEVL  900
GNETPKSIVK GRLPNNGNMD KENNGVENRS HLTSNILAER RILDFSDCET PRKETENGKS  960
STTAAAVSFS SPSSYLLKGC R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-67391936159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-67391936159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1600607ERRREKKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.161090.0boll| ovule| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012450680.10.0PREDICTED: uncharacterized protein LOC105773388
RefseqXP_012450681.10.0PREDICTED: uncharacterized protein LOC105773388
RefseqXP_012450682.10.0PREDICTED: uncharacterized protein LOC105773388
SwissprotQ9S7G71e-123MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0D2UA190.0A0A0D2UA19_G
STRINGPOPTR_0006s25840.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46742649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.10.0myb domain protein 3r-4